PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_12556_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 245aa    MW: 26805.9 Da    PI: 5.4051
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_12556_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.21.9e-181156147
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                         +g+W+++Ed  l+++v+++G+++W++I+  ++ gR++k+c++rw + 
  cra_locus_12556_iso_1_len_983_ver_3 11 KGSWSPQEDATLIKLVEEHGPRNWSLISTGIP-GRSGKSCRLRWCNQ 56
                                         799*****************************.***********985 PP

2Myb_DNA-binding57.82.5e-1865107347
                                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                          +++++Ede++++a+  +G++ W+tIar ++ gRt++ +k++w++ 
  cra_locus_12556_iso_1_len_983_ver_3  65 PFSEQEDEIIIQAHSVHGNR-WATIARLLP-GRTDNAIKNHWNST 107
                                          89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.487657IPR017930Myb domain
SuperFamilySSF466891.12E-309104IPR009057Homeodomain-like
SMARTSM007172.8E-161059IPR001005SANT/Myb domain
PfamPF002491.3E-181156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-251264IPR009057Homeodomain-like
CDDcd001674.52E-151355No hitNo description
PROSITE profilePS5129426.658112IPR017930Myb domain
SMARTSM007174.0E-1662110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-2465111IPR009057Homeodomain-like
PfamPF002492.1E-1565107IPR001005SANT/Myb domain
CDDcd001673.53E-1365108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MEAASSGERI KGSWSPQEDA TLIKLVEEHG PRNWSLISTG IPGRSGKSCR LRWCNQLSPS  60
VQHRPFSEQE DEIIIQAHSV HGNRWATIAR LLPGRTDNAI KNHWNSTLKR KRQIDSEFPV  120
SSAAAKRQCL EESVAAGSSQ EQSSSGGDDF EEMGLGLIDG PETCLSLLPP GGGTLVESLL  180
MSDDQRKGGS EKEEQRSTAE IEENCLVTIM QRMIAHEVRS YIDKIRSQGG LQIGPGFQSE  240
GLNGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A8e-4181111104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009785340.11e-100PREDICTED: myb protein-like
RefseqXP_016515570.11e-100PREDICTED: transcription factor MYB44-like
TrEMBLA0A022RUN71e-89A0A022RUN7_ERYGU; Uncharacterized protein
STRINGVIT_13s0067g01360.t016e-84(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA128831620